size-exclusion chromatography raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-12-09. Anything still debated is marked as such rather than presented as settled.
Clinical research programs have evaluated tirzepatide in adults with type 2 diabetes and in adults with obesity or excess weight. Trials generally reported reductions in glycated hemoglobin and body weight across treatment periods of several months. Since these studies enrolled defined populations under controlled conditions, the findings describe group averages rather than individual outcomes. Open questions include the durability of effects after treatment stops, variation among subgroups, and the long-term consequences of sustained dual receptor stimulation. Published trial summaries should be consulted for exact measurements rather than secondary accounts.
Tirzepatide is a synthetic peptide built from 39 amino acid residues. Its backbone derives from the native glucose-dependent insulinotropic polypeptide sequence, altered at several positions to resist enzymatic cleavage. A fatty diacid group attached through a linker extends plasma residence time by promoting reversible binding to serum albumin. The molecule carries a net negative charge near physiological pH and has a reported molecular weight close to 4813 daltons. These features separate it from shorter incretin analogs and account for its prolonged dosing interval.
After subcutaneous injection, absorption is gradual, and peak plasma levels are generally reached within one to three days. Albumin binding extends the apparent half-life to roughly five days, which supports a weekly administration schedule. Metabolism proceeds mainly through proteolytic cleavage of the peptide backbone and beta-oxidation of the fatty acid chain, rather than through cytochrome P450 pathways. Eliminated fragments are largely recycled through general protein turnover, and excretion of intact drug in urine is minimal. These properties distinguish the molecule from short-acting incretin mimetics.
Tirzepatide is a synthetic peptide of 39 amino acids engineered from the native glucose-dependent insulinotropic polypeptide sequence. Its structure incorporates several non-natural residues and a C-terminal segment derived from glucagon-like peptide-1, together with a C20 fatty diacid moiety attached through a linker. The lipophilic side chain promotes binding to serum albumin, which slows renal clearance after administration. The compound is classified as a dual incretin receptor agonist and is supplied as a lyophilized powder for reconstitution or as a preformulated solution, depending on the presentation.
The peptide activates two G protein-coupled receptors, GIPR and GLP-1R. Binding triggers adenylyl cyclase activity and raises intracellular cyclic AMP in pancreatic beta cells, which potentiates insulin release when glucose is elevated. Signaling in the central nervous system is associated with reduced appetite and lower energy intake, while effects on gastric emptying and glucagon secretion are also reported. Because activity at both receptors is retained, the pharmacological profile is often described as incretin-based rather than selective for a single receptor.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C225H348N48O68 | Includes the 39-residue backbone and the attached fatty diacid |
| Molecular weight | Approximately 4813 Da | Average mass; the monoisotopic value is slightly lower |
| Receptor targets | GIP receptor and GLP-1 receptor | Dual engagement defines the pharmacological class |
| Backbone length | 39 amino acids | Sequence modified from native glucose-dependent insulinotropic polypeptide |
| Albumin interaction | Reversible, mediated by the fatty diacid | Slows renal clearance and lengthens circulation time |
Identity and purity are usually established with reversed-phase high-performance liquid chromatography for the main peak and with mass spectrometry for the observed molecular mass. Peptide mapping after enzymatic digestion confirms the primary sequence, while amino acid analysis provides a quantitative composition check. Size-exclusion chromatography and ion-exchange chromatography are used to look for aggregates and charge variants. Water content, residual solvents, and counter-ion content are measured separately, since a lyophilised powder is often reported on an as-is basis unless a correction is applied.
Research-grade material circulates through suppliers that differ widely in documentation and testing practice, so a certificate of analysis is a starting point rather than proof of quality. Independent verification typically repeats chromatographic purity and mass confirmation on the received lot, and compares results against a retained reference standard. Regulatory status varies by jurisdiction, and a substance cleared as a medicine is not interchangeable with a research chemical of the same name. Open questions include how closely non-pharmaceutical lots match approved material in impurity profile and in aggregate content.
Solid tirzepatide is handled as a lyophilised, hygroscopic peptide powder that should be kept desiccated, protected from light, and stored frozen, typically at or below minus twenty degrees Celsius for long-term retention. Material left at ambient temperature for extended periods can take up moisture, which promotes aggregation and deamidation. Commercial liquid presentations are kept refrigerated between two and eight degrees Celsius and are not frozen. Reconstituted laboratory solutions are generally held cold and used within a short window because hydrolysis and oxidation continue slowly in solution.
Long-term storage of lyophilised peptide powder is generally at minus twenty degrees Celsius or colder, with desiccant and protection from light. Short-term storage at two to eight degrees Celsius is common during active use. In solution, stability depends strongly on pH, concentration, and the presence of preservatives, and hydrolysis or aggregation can develop over weeks. Published stability data specific to this molecule are limited, so recommended conditions for research material are usually extrapolated from general peptide handling practice rather than from a dedicated study.
Bulk peptide material is normally characterised by reversed-phase high-performance liquid chromatography, which separates the target sequence from truncation products and other closely related impurities. Ultraviolet detection near 214 nanometres is common because the peptide backbone absorbs in that region. Mass spectrometry, usually electrospray ionisation coupled to a mass analyser, is used to confirm the molecular mass. Because the molecule carries a lipophilic side chain, gradient methods often need a relatively high organic modifier fraction to elute it within a practical retention window.
Long-term storage of the solid generally relies on temperatures at or below minus twenty degrees Celsius, while short-term working stocks may be held refrigerated. Light exposure is limited because photodegradation can alter side chains over extended periods. Solutions prepared for analysis are less stable than the dry powder and are typically used within the same working day. Buffer choice matters, since some aqueous conditions favor deamidation or oxidation at specific residues. Stability data are usually generated under defined accelerated conditions and then extrapolated with stated assumptions.
Identity and purity are established with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry for confirmation of the expected mass. Peptide mapping after enzymatic digestion verifies the primary sequence and detects substitutions. Size-exclusion chromatography quantifies aggregates and fragments, which are the impurities most often tracked for peptides of this size. Residual solvents, counterions, and water content fall under separate tests described in pharmacopeial chapters. Circular dichroism or nuclear magnetic resonance may be used in research settings to probe secondary structure, though such methods are less common in routine release testing.
Mogo freezes the doppelgangers and confesses the ruse to the Corps, stating that it was done to test their will and strength and prepare them to fight against the First Lantern. After the Lights Out crossover and the destruction of Oa by Relic, Mogo became the new headquarters of the Green Lantern Corps.
In the context of nutrition, a mineral is a chemical element. Some "minerals" are essential for life, but most are not. Minerals are one of the four groups of essential nutrients; the others are vitamins, essential fatty acids, and essential amino acids. The five major minerals in the human body are calcium, phosphorus, potassium, sodium, and magnesium. The remaining minerals are called "trace elements". The generally accepted trace elements are iron, chlorine, cobalt, copper, zinc, manganese, molybdenum, iodine, selenium, and bromine; there is some evidence that there may be more. The four organogenic elements, namely carbon, hydrogen, oxygen, and nitrogen (CHON), that comprise roughly 96% of the human body by weight, are usually not considered as minerals (nutrient). In fact, in nutrition, the term "mineral" refers more generally to all the other functional and structural elements found in living organisms. Plants obtain minerals from soil. Animals ingest plants, thus moving minerals up the food chain. Larger organisms may also consume soil (geophagia) or use mineral resources such as salt licks to obtain minerals. Finally, although mineral and elements are in many ways synonymous, minerals are only bioavailable to the extent that they can be absorbed. To be absorbed, minerals either must be soluble or readily extractable by the consuming organism. For example, molybdenum is an essential mineral, but metallic molybdenum has no nutritional benefit. Many molybdates are sources of molybdenum.
=== RUNASUR === By December 2021, former Bolivian president Evo Morales announced the second summit of RUNASUR to be held in Cusco. The announcement generated various criticisms, with 11 Peruvian diplomats issuing a public statement denouncing RUNASUR as "a clear external threat to sovereignty, independence and national security" because it could be an instrument through which Bolivia would obtain access to the sea, and urging the government not to allow the summit to take place. In addition, it became known that the Revolutionary Agrarian Federation of Cusco (FARTAC), one of RUNASUR's organizers, advocated for the presence of the Movement for Socialism (MAS) party in Peru, and that the party, then led by Morales, had established a branch in the city of Cusco under the leadership of the Bolivian Isabel Ara Condori. Four trips by Morales to Peru since Castillo's victory in the 2021 elections were reported, during which he met with Castillo and Vladimir Cerrón, leader of Perú Libre. In November of that same year, the foreign relations committee of the Peruvian congress declared Morales a persona non grata for interference in the country's internal politics and the carrying out of proselytizing actions "clearly detrimental to the interests of the Peruvian people". The foreign ministry issued a statement declaring that the RUNASUR summit was not linked to the government. Ultimately, the summit was never held.
=== Executive committee === The management of the Society is vested in an Executive Committee made up of Officers and General Members, they also act as Trustees of the Society. There are currently 10 officers of the Society namely the Chair, Vice-Chair, Treasurer, General Secretary, Meetings Secretary, Papers Secretary, Education Officer, Publicity Secretary, Special Interest Group Co-ordinator, and Digital Communications Officer.
"The One You Know" peaked at No. 9 on Billboard's Mainstream Rock chart. During an interview with Eddie Trunk on Trunk Nation on May 7, 2018, Jerry Cantrell said that the new album would be released at the end of August 2018. The band also revealed that they talked to director Adam Mason, who is making a dark sci-film, about doing two separate pieces of art and maybe molding them together, and that the music video for "The One You Know" is the first chapter of molding Mason's film and the band's music videos together. The second single, "So Far Under", was released on Alice in Chains' YouTube channel and on streaming platforms on June 27, 2018. It was also announced that the album would be titled Rainier Fog, with the release date scheduled for August 24, 2018. The album's artwork and the track listing were also revealed on the same day. Jerry Cantrell told Rolling Stone that the title Rainier Fog was inspired by the Mount Rainier in Seattle, and the title track is a tribute to the Seattle music scene. "This song is a little homage to all of that: where we come from, who we are, all of the triumphs, all of the tragedies, lives lived." The album's third single, "Never Fade", was released on August 10, 2018, through digital and streaming services. The song is a tribute dedicated to frontman William DuVall's grandmother, Chris Cornell, and Alice in Chains' original singer Layne Staley. "Never Fade" peaked at No. 10 on Billboard's Mainstream Rock chart.
Sources: en.wikipedia.org
According to a study by Colombia's National Centre for Historical Memory, 220,000 people died in the conflict between 1958 and 2013, most of them civilians (177,307 civilians and 40,787 fighters), and more than five million civilians were forced from their homes between 1985 and 2012, generating the world's second-largest population of internally displaced persons (IDPs). 16.9% of the population in Colombia has been a direct victim of the war. 2.3 million children have been displaced from their homes and 45,000 children have been killed, according to national figures cited by UNICEF. In total, one in three of the 7.6 million registered victims of the conflict are children and 8,000 minors have disappeared since 1985. A Special Unit was created to search for persons deemed as missing within the context of and due to the armed conflict. As of April 2022, the Single Registry of Victims reported 9,263,826 victims of the Colombian conflict, with 2,048,563 of them being children. Approximately 80% of those killed in the conflict have been civilians. In 2022, the Truth Commission of Colombia estimated that paramilitaries were responsible for 45% of civilian deaths, the guerrillas for 27%, and state forces for 12%, with the remaining 16% attributable to other groups or mixed responsibility. On June 23, 2016, the Colombian government and the FARC rebels signed a historic ceasefire deal, bringing them closer to ending more than five decades of conflict.
==== Overall genital system structure ==== The genital system of an adult male P. phalangioides is located in the ventral portion of the opisthosoma and can be characterized by a large pair of testes and thin, twisted vasa deferentia which become thicker upon nearing the genital opening of the male pedipalp. These vasa deferentia distally fuse creating the ductus ejaculatorius of the spider. The ductus ejaculatorius is composed of lumen which contains large quantities of spermatozoa and other secretions. This variety of secretions is not seen in subadult males whose lumen only contains dense secretion matrix. Ventrally surrounding specific portions of the genital tract are apullate silk glands, and overall, the genital system is bordered by parts of the midgut gland. All stages of spermatogenesis are apparent in the adult testes, and the spermatozoa are coiled. In order to reach this stage with a fully formed male genital system, P. phalangioides must first go through two subadult phases.
=== Combined & global === A different modality is when lysosomes do not just act alone, but in concert with the ER. In this scenario, lysosomes first supply a local, 'trigger' Ca2+ release that then secondarily recruits the IP3Rs or RyRs on the ER by Calcium-induced calcium release (the 'amplifier'). In this mode, lysosomes indirectly evoke a global cytosolic Ca2+ signal (which is actually mediated by the ER). In this way, lysosomal Ca2+ release is amplified, in what is referred to as the 'trigger hypothesis'.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
== Genetic code and the RNA world == Modern evidence suggests that early cellular evolution occurred in a biological realm radically distinct from modern biology. It is thought that in this ancient realm, the current genetic role of DNA was largely filled by RNA, and catalysis was also largely mediated by RNA (that is, by ribozyme counterparts of enzymes). This concept is known as the RNA world hypothesis. According to this hypothesis, the ancient RNA world transitioned into the modern cellular world via the evolution of protein synthesis, followed by replacement of many cellular ribozyme catalysts by protein-based enzymes. Proteins are much more flexible in catalysis than RNA due to the existence of diverse amino acid side chains with distinct chemical characteristics. The RNA record in existing cells appears to preserve some 'molecular fossils' from this RNA world. These RNA fossils include the ribosome itself (in which RNA catalyzes peptide-bond formation), the modern ribozyme catalyst RNase P, and RNAs. The nearly universal genetic code preserves some evidence for the RNA world. For instance, recent studies of transfer RNAs, the enzymes that charge them with amino acids (the first step in protein synthesis) and the way these components recognize and exploit the genetic code, have been used to suggest that the universal genetic code emerged before the evolution of the modern amino acid activation method for protein synthesis. The first RNA polymers probably emerged prior to 4.17 Gya if life originated at freshwater environments similar to Darwin's warm little pond.
Multivariate calibration: Used to develop models that correlate instrument responses (e.g., spectra) to analyte concentrations, essential in techniques like near-infrared spectroscopy. Pattern recognition: Employed to classify samples based on their analytical profile, with applications in food authenticity and medical diagnostics. Machine learning and artificial intelligence: These techniques are increasingly used for predictive modeling, optimizing analytical methods, and automating data interpretation.
Successful international boycotts of Australian Merino wool in the early 2000s set those invested in Australian sheep rearing on the hunt for alternatives. The publicity generated intense interest in finding a replacement for mulesing that domestic and international consumers would accept. An adaptation of the freeze branding process was hit upon in the 2010s. The new technique was quickly christened steining after its designer, John Steinfort, an Australian veterinary scientist. In 2019 Australian Wool Network (AWN), a private corporation servicing the Australian wool industry, provided Steinfort funding to commercialize the technique. During steining hollow cupronickel clamping jaws about 4 inches (10 cm) long are used to pinch up rolls of skin beneath the tail and near the anus of a lamb. No shaving is required in this application of freeze branding. Once sufficient skin is in the clamps liquid nitrogen is pumped through the jaws and onto the pinched skin. This rapidly freezes the lamb's skin as it drips out of the jaws and through the animal's fleece. The goal is to achieve a level of cellular injury that prevents future hair growth but not so much that a 3rd-degree cold burn is created. Pinching the skin is thought to mitigate the degree of cold burn by removing it somewhat from the muscles and connective tissue beneath. The treated skin goes through the same stages of healing seen in the long method of freeze-branding larger livestock, concluding with permanent hairlessness.
== Management == Management focuses on reducing cardiovascular and metabolic risk through lifestyle modification, pharmacologic therapy, and, in selected cases, surgery. Because metabolic syndrome represents a cluster of interrelated conditions, treatment typically targets each component individually rather than the syndrome as a single entity. Lifestyle modification is the cornerstone of management of metabolic syndrome. A randomized control trial of 618 adults with metabolic syndrome evaluated an intensive lifestyle modification conducted over six months to encourage increased vegetable intake, brisk walks, sensory awareness, and emotion regulation, compared with a control intervention of monthly educational mailings. Members of the intervention group were ~33% more likely to experience remission of metabolic syndrome.
In a bioassay, hPL mimics the action of prolactin, yet it is unclear whether hPL has any role in human lactation. Metabolic: ↓ maternal insulin sensitivity (insulin resistance), leading to an increase in maternal blood glucose levels. ↓ maternal glucose utilization, which helps ensure adequate fetal nutrition (the mother responds by increasing beta cells). Chronic hypoglycemia leads to a rise in hPL. ↑ lipolysis with the release of free fatty acids. With fasting and release of hPL, free fatty acids become available for the mother as free fatty acids do not cross the placenta, so that relatively more glucose can be utilized by the fetus. With sustained fasting, maternal ketones formed from free fatty acids can cross the placenta and be used by the fetus. These functions help support fetal nutrition even in the case of maternal malnutrition. hPL is a potent agonist of the prolactin receptor and a weak agonist of the growth hormone receptor.
Sources: en.wikipedia.org
It is a synthetic peptide that activates both the GIP and GLP-1 receptors, making it a dual agonist. Approved products are given by injection rather than by mouth. It is not a small molecule and does not belong to the older sulfonylurea or thiazolidinedione families.
Engaging two receptors recruits signaling pathways that only partly coincide. This can shift the magnitude of effects on insulin release, glucagon levels and appetite relative to selective agents. Whether the pairing delivers benefits beyond a simple sum of the two is still debated in the literature.
The proportional contribution of each receptor to observed clinical effects has not been fully separated. Long-term consequences of continuous dual stimulation are likewise unclear. Investigators continue to probe these points through laboratory and clinical work.
It is a synthetic linear peptide that acts as a dual agonist at the GIP and GLP-1 receptors. It combines a modified incretin backbone with a fatty diacid side chain that extends its circulation time. It is not a small-molecule drug and is not orally absorbed in its native form.